- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name Acetyl-Histone H3-K9 Rabbit mAb Catalog No. A22567 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55732 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.Immunogen information
Immunogen A synthetic acetylated peptide around K9 of human Acetyl-Histone H3-K9 (NP_003520.1). Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY Gene ID Swiss Prot Synonyms H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A Calculated MW 15kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P IF/ICC IP ChIP DB Recommended dilution - DB 1:10000 - 1:190000
- WB 1:2000 - 1:10000
- IHC-P 1:500 - 1:1000
- IF/ICC 1:500 - 1:1000
- ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa TSA, NIH/3T3 TSA Cellular location Chromosome, Nucleus 
Western blot analysis of HeLa, using Acetyl-Histone H3-K9 antibody (A22567) at 1:10000 dilution.HeLa cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of NIH/3T3, using Acetyl-Histone H3-K9 antibody (A22567) at 1:10000 dilution.NIH/3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H3-K9 antibody (A22567) at 1:160000 dilution.

Immunohistochemistry analysis of paraffin-embedded human lung using Acetyl-Histone H3-K9 Rabbit mAb (A22567) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using Acetyl-Histone H3-K9 Rabbit mAb (A22567) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse lung using Acetyl-Histone H3-K9 Rabbit mAb (A22567) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat lung using Acetyl-Histone H3-K9 Rabbit mAb (A22567) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of HeLa treated by TSA and HeLa cells using Acetyl-Histone H3-K9 Rabbit mAb (A22567) at dilution of 1:800 (40x lens). Blue: DAPI for nuclear staining.

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K9 antibody (A22567) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic acetylated peptide around K9 of human Acetyl-Histone H3-K9 (NP_003520.1). Isotype IgG







