быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Acetyl-Histone H3-K18 Rabbit mAb (A20735)
- Описание
- Характеристики
-
Overview
Product name Acetyl-Histone H3-K18 Rabbit mAb Catalog No. A20735 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53056 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.Immunogen information
Immunogen A synthetic acetylated peptide around K18 of human Histone H3 (P68431). Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY Gene ID Swiss Prot Synonyms H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; H3C1 Calculated MW 15kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P IP ChIP ChIP-seq DB CUT&Tag Recommended dilution - DB 1:10000 - 1:100000
- WB 1:2000 - 1:10000
- IHC-P 1:100 - 1:500
- ChIP 1:50 - 1:200
- CUT&Tag 10⁵ cells /1 μg
- ChIP-seq 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa TSA, NIH/3T3 TSA, C6 TSA Cellular location Chromosome, Nucleus 
CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1 μg Acetyl-Histone H3-K18 Rabbit mAb (A20735), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of H3K18me1 in representative gene loci (RPL30), as shown in figure.
Chromatin immunoprecipitations were performed with cross-linked chromatin from 293T cells and Acetyl-Histone H3-K18 Rabbit mAb (A20735). The ChIP sequencing results indicate the enrichment pattern of Acetyl-Histone H3-K18 in selected genomic region and representative gene loci (RPL30), as shown in figure.
Western blot analysis of extracts of various cell lines, using Acetyl-Histone H3-K18 Rabbit mAb (A20680) at 1:1000 dilution.HeLa cells and NIH/3T3 cells and C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H3-K18 Rabbit mAb (A20735) at 1:100000 dilution.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Acetyl-Histone H3-K18 Rabbit mAb (A20735) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse lung using Acetyl-Histone H3-K18 Rabbit mAb (A20735) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat colon using Acetyl-Histone H3-K18 Rabbit mAb (A20735) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K18 Rabbit mAb (A20735) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic acetylated peptide around K18 of human Histone H3 (P68431). Isotype IgG