![[KO Validated] ITCH Rabbit pAb (A15612)](/upload/resize_cache/iblock/3b9/340_340_140cd750bba9870f18aada2478b24840a/og4avgdgbqbha05fwim9nx5fbaihl3po.jpg "[KO Validated] ITCH Rabbit pAb (A15612)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ITCH Rabbit pAb (A15612)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ITCH Rabbit pAb Catalog No. A15612 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein plays a role in multiple cellular processes including erythroid and lymphoid cell differentiation and the regulation of immune responses. Mutations in this gene are a cause of syndromic multisystem autoimmune disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-155 of ITCH (NP_001244066.1). Sequence MSDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETT Gene ID Swiss Prot Synonyms AIF4; AIP4; ADMFD; NAPP1 Calculated MW 103kDa Observed MW 103kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, THP-1, NIH/3T3, C6, Mouse lung, Mouse kidney, Rat lung, Rat spleen Cellular location cell cortex, cytoplasm, cytoplasmic vesicle, cytosol, extracellular exosome, nucleoplasm, plasma membrane Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using ITCH antibody (A15612) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from normal (control) and ITCH knockout (KO) 293T cells, using ITCH antibody (A15612) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-155 of ITCH (NP_001244066.1). KO Validated Validated Isotype IgG