![[KO Validated] KMT5C Rabbit pAb (A16235)](/upload/resize_cache/iblock/ef5/340_340_140cd750bba9870f18aada2478b24840a/rsh7vsyr62xscxbzdntv88nc1jez6l1p.jpg "[KO Validated] KMT5C Rabbit pAb (A16235)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] KMT5C Rabbit pAb (A16235)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] KMT5C Rabbit pAb Catalog No. A16235 Host species Rabbit Purification method Affinity purification Isotype IgG Background
SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20) (Schotta et al., 2004 [PubMed 15145825]).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2). Sequence FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC Gene ID Swiss Prot Synonyms SUV420H2; Suv4-20h2 Calculated MW 52kDa Observed MW 52kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, Jurkat, Mouse thymus Cellular location Chromosome, Nucleus 
Western blot analysis of extracts of various cell lines, using KMT5C antibody (A16235) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Mouse thymus, using KMT5C antibody (A16235) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts from normal (control) and KMT5C Rabbit pAb knockout (KO) 293T cells, using KMT5C Rabbit pAb antibody (A16235) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2). KO Validated Validated Isotype IgG