[KO Validated] Insulin-degrading enzyme (IDE) Rabbit pAb (A1630)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] Insulin-degrading enzyme (IDE) Rabbit pAb
Catalog No.	A1630
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a zinc metallopeptidase that degrades intracellular insulin, and thereby terminates insulins activity, as well as participating in intercellular peptide signalling by degrading diverse peptides such as glucagon, amylin, bradykinin, and kallidin. The preferential affinity of this enzyme for insulin results in insulin-mediated inhibition of the degradation of other peptides such as beta-amyloid. Deficiencies in this protein's function are associated with Alzheimer's disease and type 2 diabetes mellitus but mutations in this gene have not been shown to be causitive for these diseases. This protein localizes primarily to the cytoplasm but in some cell types localizes to the extracellular space, cell membrane, peroxisome, and mitochondrion. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described but have not been experimentally verified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Insulin-degrading enzyme (Insulin-degrading enzyme (IDE)) (NP_004960.2).
Sequence	MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYS
Gene ID
Swiss Prot
Synonyms	INSULYSIN
Calculated MW	118kDa
Observed MW	118kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IF/ICC
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:10 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	DU145, Mouse liver
Cellular location	Cell membrane, Cytoplasm, Secreted
Customer validation	WB(Mus musculus)

Western blot analysis of extracts of various cell lines, using Insulin-degrading enzyme (Insulin-degrading enzyme (IDE)) antibody (A1630) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).

Western blot analysis of extracts from normal (control) and Insulin-degrading enzyme (Insulin-degrading enzyme (IDE)) knockout (KO) HeLa cells, using Insulin-degrading enzyme (Insulin-degrading enzyme (IDE)) antibody (A1630) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunofluorescence analysis of A549 cells using Insulin-degrading enzyme (Insulin-degrading enzyme (IDE)) antibody (A1630). Blue: DAPI for nuclear staining.

Key applications	Western blotting, Immunofluorescence
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Insulin-degrading enzyme (Insulin-degrading enzyme (IDE)) (NP_004960.2).
KO Validated	Validated
Isotype	IgG