![[KO Validated] Lamin B1 Rabbit pAb (A16909)](/upload/resize_cache/iblock/391/340_340_140cd750bba9870f18aada2478b24840a/15xv8uxmaad7ylcmwh3wnfb2rp6bxzro.jpg "[KO Validated] Lamin B1 Rabbit pAb (A16909)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Lamin B1 Rabbit pAb (A16909)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Lamin B1 Rabbit pAb Catalog No. A16909 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 503-586 of human Lamin B1 (P20700). Sequence AGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM Gene ID Swiss Prot Synonyms LMN; ADLD; LMN2; LMNB; MCPH26 Calculated MW 66kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Jurkat, HT-29, HeLa, U-251MG, mouse liver, mouse brain, mouse spleen, rat liver Cellular location Lipid-anchor, Nucleoplasmic side, Nucleus inner membrane Customer validation WB(Mus musculus, Rattus norvegicus, Homo sapiens)
Co-IP(Mus musculus)
Western blot analysis of extracts of various cell lines, using Lamin B1 antibody (A16909) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts from normal (control) and Lamin B1 knockout (KO) HeLa cells, using Lamin B1 antibody (A16909) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 503-586 of human Lamin B1 (P20700). KO Validated Validated Isotype IgG