быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] NME1/NM23A Rabbit pAb (A17999)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] NME1/NM23A Rabbit pAb Catalog No. A17999 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 90 to the C-terminus of human NME1/NM23A (NP_000260.1). Sequence MLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE Gene ID Swiss Prot Synonyms NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1 Calculated MW 17kDa Observed MW 21kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts from normal (control) and NME1/NM23A knockout (KO) 293T cells, using NME1/NM23A antibody (A17999) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 90 to the C-terminus of human NME1/NM23A (NP_000260.1). KO Validated Validated Isotype IgG







