![[KO Validated] Bak Rabbit pAb (A18002)](/upload/resize_cache/iblock/7a6/340_340_140cd750bba9870f18aada2478b24840a/70gbscmvpwxyyac215ukte9m6dij20jn.jpg "[KO Validated] Bak Rabbit pAb (A18002)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Bak Rabbit pAb (A18002)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Bak Rabbit pAb Catalog No. A18002 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-50 of human Bak (NP_001179.1). Sequence MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAE Gene ID Swiss Prot Synonyms BAK; CDN1; BCL2L7; BAK-LIKE Calculated MW 23kDa Observed MW 25kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Mitochondrion membrane, Single-pass membrane protein 
Western blot analysis of extracts from normal (control) and Bak knockout (KO) HeLa cells, using Bak antibody (A18002) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-50 of human Bak (NP_001179.1). KO Validated Validated Isotype IgG