![[KO Validated] MAP3K1 Rabbit pAb (A18041)](/upload/resize_cache/iblock/5e8/340_340_140cd750bba9870f18aada2478b24840a/zkrgoa3gccvx8s31783o43jfvp8n81is.jpg "[KO Validated] MAP3K1 Rabbit pAb (A18041)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] MAP3K1 Rabbit pAb (A18041)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] MAP3K1 Rabbit pAb Catalog No. A18041 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human MAP3K1 (NP_005912.1). Sequence TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW Gene ID Swiss Prot Synonyms MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1 Calculated MW 164kDa Observed MW 164kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location cytoplasm, cytosol 
Western blot analysis of extracts from normal (control) and MAP3K1 knockout (KO) HeLa cells, using MAP3K1 antibody (A18041) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human MAP3K1 (NP_005912.1). KO Validated Validated Isotype IgG