![[KO Validated] 14-3-3 gamma Rabbit pAb (A18060)](/upload/resize_cache/iblock/c7f/340_340_140cd750bba9870f18aada2478b24840a/bhijj01yrrxwwkdu0aj62h79mqm7na0v.jpg "[KO Validated] 14-3-3 gamma Rabbit pAb (A18060)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] 14-3-3 gamma Rabbit pAb (A18060)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] 14-3-3 gamma Rabbit pAb Catalog No. A18060 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (P61981). Sequence VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA Gene ID Swiss Prot Synonyms DEE56; EIEE56; PPP1R170; 14-3-3GAMMA Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Cytoplasm Customer validation WB(Mus musculus)
Western blot analysis of extracts from normal (control) and 14-3-3 gamma knockout (KO) 293T cells, using 14-3-3 gamma antibody (A18060) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (P61981). KO Validated Validated Isotype IgG