+7-495-308-45-67 Заказать звонок

[KO Validated] Bax Rabbit mAb (A18642)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] Bax Rabbit mAb
Catalog No.	A18642
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC5006-06

Background

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 10-70 of human Bax (NP_620116.1).
Sequence	GGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL
Gene ID
Swiss Prot
Synonyms	BCL2L4
Calculated MW	21kDa
Observed MW	21kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, HT-1080
Cellular location	Cytoplasm, Mitochondrion membrane, Single-pass membrane protein
Customer validation	WB(Homo sapiens, Mus musculus) IHC(Oreochromis niloticus)

Western blot analysis of extracts from wild type (WT) and Bax knockout (KO) 293T cells, using Bax antibody (A18642) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts from HT-1080 cells, using Bax antibody (A18642) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of HT-1080, using [KO Validated] Bax Rabbit mAb (A18642) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts from wild type(WT) and [KO Validated] Bax knockout (KO) 293T(KO) cells, using [KO Validated] Bax Rabbit mAb (A18642) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of paraffin-embedded mouse testis using [KO Validated] Bax Rabbit mAb (A18642) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Confocal imaging of HeLa cells using [KO Validated] Vimentin Rabbit mAb (A19607, dilution 1:100) (Red). The cells were counterstained with [KO Validated] Bax Rabbit mAb (A18642, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Immunoprecipitation analysis of 200 μg extracts of 293T using 3 μg Bax antibody (A18642). Western blot was performed from the immunoprecipitate using Bax antibody (A18642) at a dilution of 1:1000.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 10-70 of human Bax (NP_620116.1).
KO Validated	Validated
Isotype	IgG