![[KO Validated] c-Myc Rabbit mAb (A19032)](/upload/resize_cache/iblock/8f1/340_340_140cd750bba9870f18aada2478b24840a/42cuznssrndskbtf3u12t154xvcj1nzg.jpg "[KO Validated] c-Myc Rabbit mAb (A19032)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] c-Myc Rabbit mAb (A19032)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] c-Myc Rabbit mAb Catalog No. A19032 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0412 Background
This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (P01106). Sequence MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLE Gene ID Swiss Prot Synonyms MRTL; MYCC; c-Myc; bHLHe39 Calculated MW 51kDa Observed MW 50-60kDa Applications
Reactivity Human, Mouse Tested applications WB IP ChIP CUT&Tag Recommended dilution - WB 1:500 - 1:1000
- ChIP 1:50 - 1:200
- CUT&Tag 10⁵ cells /1 μg
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, MCF7, HCT 116, Mouse ovary Cellular location Nucleus, nucleolus, nucleoplasm Customer validation (293T MOLT4 IGROV-1)
WB(Homo sapiens, Mus musculus, Cyprinus carpio)
UT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1μg c-Myc Rabbit mAb(A19032), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of ESE1 in representative gene loci (NPM1), as shown in figure.
Western blot analysis of extracts of various cell lines, using c-Myc antibody (A19032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Mouse ovary, using c-Myc antibody (A19032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Western blot analysis of extracts from wild type (WT) and c-Myc knockout (KO) HCT 116 cells, using c-Myc antibody (A19032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Chromatin immunoprecipitation analysis of extracts of K562 cells, using c-Myc antibody (A19032) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (P01106). KO Validated Validated Isotype IgG