- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name [KO Validated] GSK3α Rabbit mAb Catalog No. A19060 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0462 Background
This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSK3α (P49840). Sequence MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKV Gene ID Swiss Prot Synonyms GSK3 alpha; GSK3A Calculated MW 51kDa Observed MW 51kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HeLa, Rat lung, Mouse brain Cellular location apical dendrite, axon, beta-catenin destruction complex, cytoplasm, cytosol, mitochondrion, nucleus, postsynapse, proximal dendrite Customer validation WB(Homo sapiens,Mus musculus)

Western blot analysis of extracts from wild type (WT) and GSK3α knockout (KO) HeLa cells, using GSK3α antibody (A19060) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Rat lung, using GSK3α antibody (A19060) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Mouse brain, using GSK3α antibody (A19060) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg GSK3α antibody (A19060). Western blot was performed from the immunoprecipitate using GSK3α antibody (A19060) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSK3α (P49840). KO Validated Validated Isotype IgG







