![[KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068)](/upload/resize_cache/iblock/3fb/340_340_140cd750bba9870f18aada2478b24840a/sz3aq70663wijhc8flt50zvqx3boitd9.jpg "[KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb Catalog No. A19068 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0457 Background
This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss of the encoded protein is associated with bleeding disorder platelet-type 9. Antibodies against this protein are found in several immune disorders, including neonatal alloimmune thrombocytopenia. This gene is located adjacent to a related alpha subunit gene. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2 (ITGA2/CD49b) (P17301). Sequence GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS Gene ID Swiss Prot Synonyms BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2 Calculated MW 129kDa Observed MW 150kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, A549, Mouse large intestine, Mouse lung, Mouse spleen, Rat lung Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of A549 cells, using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of various lysates, using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from wild type(WT) and Integrin alpha 2 (ITGA2/CD49b) knockout (KO) 293T cells, using Integrin alpha 2 (ITGA2/CD49b) antibody (A19068) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Integrin alpha 2 (ITGA2/CD49b) (ITGA2/CD49b) Rabbit mAb (A19068) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2 (ITGA2/CD49b) (P17301). KO Validated Validated Isotype IgG