![[KO Validated] N-Cadherin Rabbit mAb (A19083)](/upload/resize_cache/iblock/a65/340_340_140cd750bba9870f18aada2478b24840a/dcjn0vvvpa2tzom2b6ai2g5fpuv4eojh.jpg "[KO Validated] N-Cadherin Rabbit mAb (A19083)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] N-Cadherin Rabbit mAb (A19083)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] N-Cadherin Rabbit mAb Catalog No. A19083 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0371 Background
This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human N Cadherin (P19022). Sequence AKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP Gene ID Swiss Prot Synonyms CDHN; NCAD; ACOGS; ADHD8; CD325; ARVD14; CDw325 Calculated MW 100kDa Observed MW 140kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, 293T, NIH/3T3, C6 Cellular location Cell membrane, Single-pass type I membrane protein Customer validation WB(Homo sapiens, Mus musculus, Rattus norvegicus, mouse)
IHC(Mus musculus, Homo sapiens)
IHC(Homo sapiens)
IF(Homo sapiens)
IHC(Homo sapiens)
IF(Homo sapiens)
Western blot analysis of extracts from wild type (WT) and N-Cadherin knockout (KO) HeLa cells, using N-Cadherin antibody (A19083) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Western blot analysis of extracts of various cell lines, using N-Cadherin antibody (A19083) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Immunohistochemistry analysis of paraffin-embedded mouse heart using N-Cadherin Rabbit mAb (A19083) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat heart using N-Cadherin Rabbit mAb (A19083) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of mouse heart using N-Cadherin Rabbit mAb (A19083) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human N Cadherin (P19022). KO Validated Validated Isotype IgG