![[KO Validated] HMGB1 Rabbit mAb (A19529)](/upload/resize_cache/iblock/331/340_340_140cd750bba9870f18aada2478b24840a/ltitrh9j9mhaer2c1z2rmza5nftk6gz1.jpg "[KO Validated] HMGB1 Rabbit mAb (A19529)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] HMGB1 Rabbit mAb (A19529)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] HMGB1 Rabbit mAb Catalog No. A19529 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0001 Background
This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB1 (P09429). Sequence SAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE Gene ID Swiss Prot Synonyms HMG1; HMG3; HMG-1; SBP-1 Calculated MW 25kDa Observed MW 25kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T, HeLa, Jurkat, Mouse liver, Mouse brain, Mouse testis, Rat liver Cellular location Cell membrane, Chromosome, Cytoplasm, Endoplasmic reticulum-Golgi intermediate compartment, Endosome, Extracellular side, Nucleus, Peripheral membrane protein, Secreted Customer validation IF(Rattus norvegicus, Mus musculus)
WB(Bovine, Mus musculus, Homo sapiens)
IHC(Rattus norvegicus)
Western blot analysis of extracts of various cell lines, using HMGB1 antibody (A19529) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of extracts from wild type (WT) and HMGB1 knockout (KO) 293T cells, using HMGB1 antibody (A19529) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of extracts of various cell lines, using HMGB1 antibody (A19529) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry of paraffin-embedded human liver cancer using [KO Validated] HMGB1 Rabbit mAb (A19529) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse colon using [KO Validated] HMGB1 Rabbit mAb (A19529) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse kidney using [KO Validated] HMGB1 Rabbit mAb (A19529) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse liver using [KO Validated] HMGB1 Rabbit mAb (A19529) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse testis using [KO Validated] HMGB1 Rabbit mAb (A19529) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat liver using [KO Validated] HMGB1 Rabbit mAb (A19529) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of NIH-3T3 cells using [KO Validated] HMGB1 Rabbit mAb (A19529, dilution 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB1 (P09429). KO Validated Validated Isotype IgG