![[KO Validated] DNMT3A Rabbit mAb (A19659)](/upload/resize_cache/iblock/89e/340_340_140cd750bba9870f18aada2478b24840a/y2uz6vpp8dg9fob5padld1ve9atuxchm.jpg "[KO Validated] DNMT3A Rabbit mAb (A19659)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] DNMT3A Rabbit mAb (A19659)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] DNMT3A Rabbit mAb Catalog No. A19659 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0138 Background
CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-650 of human DNMT3A (Q9Y6K1). Sequence GNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVL Gene ID Swiss Prot Synonyms TBRS; HESJAS; DNMT3A2; M.HsaIIIA Calculated MW 102kDa Observed MW 85kDa/95kDa/130kDa Applications
Reactivity Human, Mouse Tested applications WB IP Recommended dilution - WB 1:100 - 1:500
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples 293T Cellular location Cytoplasm, Nucleus Customer validation WB(Mus musculus)
ChIP(Homo sapiens)
Western blot analysis of Mouse Thymus, using DNMT3A Rabbit mAb (A19659) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from wild type (WT) and [KO Validated] DNMT3A Rabbit mAb knockout (KO) 293T cells, using [KO Validated] DNMT3A Rabbit mAb (A19659) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg DNMT3A antibody (A19659). Western blot was performed from the immunoprecipitate using DNMT3A antibody (A19659) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-650 of human DNMT3A (Q9Y6K1). KO Validated Validated Isotype IgG