![[KO Validated] cIAP1 Rabbit mAb (A19688)](/upload/resize_cache/iblock/ffb/340_340_140cd750bba9870f18aada2478b24840a/kcpbe4pkbor8b2pdfk3nxwsvrh8r08sf.jpg "[KO Validated] cIAP1 Rabbit mAb (A19688)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] cIAP1 Rabbit mAb (A19688)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] cIAP1 Rabbit mAb Catalog No. A19688 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0168 Background
The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded protein inhibits apoptosis induced by serum deprivation and menadione, a potent inducer of free radicals. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human cIAP1 (Q13490). Sequence MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPI Gene ID Swiss Prot Synonyms API1; MIHB; HIAP2; RNF48; cIAP1; Hiap-2; c-IAP1 Calculated MW 70kDa Observed MW 68kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HepG2, 293T, BxPC-3, HeLa, Jurkat Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using cIAP1 antibody (A19688) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts from wild type(WT) and cIAP1 knockout (KO) 293T cells, using cIAP1 antibody (A19688) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded rat ovary using cIAP1 antibody (A19688) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human cIAP1 (Q13490). KO Validated Validated Isotype IgG