[KO Validated] IRF3 Rabbit mAb (A19717)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] IRF3 Rabbit mAb
Catalog No.	A19717
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0198

Background

This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. The protein plays an important role in the innate immune response against DNA and RNA viruses. Mutations in this gene are associated with Encephalopathy, acute, infection-induced, herpes-specific, 7.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF3 (Q14653).
Sequence	DFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLA
Gene ID
Swiss Prot
Synonyms	IIAE7
Calculated MW	47kDa
Observed MW	57kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Jurkat, 293T, HeLa
Cellular location	Cytoplasm, Nucleus
Customer validation	(T47D、HeLa、 U2-OS、 PC-3、 RPMI-Q26、 MOLT4、 293T) WB(Homo sapiens, Mus musculus)

Western blot analysis of extracts from wild type (WT) and IRF3 knockout (KO) HeLa cells, using IRF3 antibody (A19717) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of extracts of various cell lines, using IRF3 antibody (A19717) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Key applications	Western blotting
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF3 (Q14653).
KO Validated	Validated
Isotype	IgG