![[KO Validated] Lrwd1 Rabbit pAb (A19843)](/upload/resize_cache/iblock/1c8/340_340_140cd750bba9870f18aada2478b24840a/dcdhs17pn3qx8v2ahucx7ier63a4dmju.jpg "[KO Validated] Lrwd1 Rabbit pAb (A19843)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Lrwd1 Rabbit pAb (A19843)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Lrwd1 Rabbit pAb Catalog No. A19843 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene interacts with components of the origin recognition complex (ORC) and regulates the formation of the prereplicative complex. The encoded protein stabilizes the ORC and therefore aids in DNA replication. This protein is required for the G1/S phase transition of the cell cycle. In addition, the encoded protein binds to trimethylated histone H3 in heterochromatin and recruits the ORC and lysine methyltransferases, which help maintain the repressive heterochromatic state. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Lrwd1 (NP_690852.1). Sequence ASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAFEPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTAL Gene ID Swiss Prot Synonyms ORCA; CENP-33 Calculated MW 71kDa Observed MW 71kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Chromosome, Cytoplasm, Nucleus, centromere, centrosome, cytoskeleton, microtubule organizing center, telomere 
Western blot analysis of extracts from normal (control) and Lrwd1 knockout (KO) HeLa cells, using Lrwd1 antibody (A19843) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Lrwd1 (NP_690852.1). KO Validated Validated Isotype IgG