быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] NDUFA4 Rabbit pAb (A19893)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] NDUFA4 Rabbit pAb Catalog No. A19893 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1). Sequence MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF Gene ID Swiss Prot Synonyms MLRQ; CI-9k; COXFA4; MISTR1; MRCAF1; CI-MLRQ; MC4DN21 Calculated MW 9kDa Observed MW 9kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Matrix side, Mitochondrion inner membrane, Peripheral membrane protein 
Western blot analysis of extracts from normal (control) and NDUFA4 knockout (KO) 293T cells, using NDUFA4 antibody (A19893) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1). KO Validated Validated Isotype IgG







