![[KO Validated] ALDH3A2 Rabbit pAb (A19899)](/upload/resize_cache/iblock/9e1/340_340_140cd750bba9870f18aada2478b24840a/ods2soq0kgrgwp1wbuga9irxuk01tv9c.jpg "[KO Validated] ALDH3A2 Rabbit pAb (A19899)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ALDH3A2 Rabbit pAb (A19899)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ALDH3A2 Rabbit pAb Catalog No. A19899 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human ALDH3A2 (NP_001026976.1). Sequence EASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKIAFGGETDEATRYIAPTVLTD Gene ID Swiss Prot Synonyms SLS; FALDH; ALDH10 Calculated MW 55kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Cytoplasmic side, Endoplasmic reticulum membrane, Single-pass membrane protein 
Western blot analysis of extracts from normal (control) and ALDH3A2 knockout (KO) HeLa cells, using ALDH3A2 antibody (A19899) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human ALDH3A2 (NP_001026976.1). KO Validated Validated Isotype IgG