![[KO Validated] LYAR Rabbit pAb (A19900)](/upload/resize_cache/iblock/2a8/340_340_140cd750bba9870f18aada2478b24840a/7369vqzu2o3xntpvzscnn3n3qwust893.jpg "[KO Validated] LYAR Rabbit pAb (A19900)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] LYAR Rabbit pAb (A19900)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] LYAR Rabbit pAb Catalog No. A19900 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables several functions, including DNA-binding transcription factor binding activity; identical protein binding activity; and transcription regulator inhibitor activity. Involved in several processes, including erythrocyte development; negative regulation of innate immune response; and regulation of transcription, DNA-templated. Located in nucleolus and nucleoplasm.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-160 of human LYAR (NP_060286.1). Sequence GESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVAN Gene ID Swiss Prot Synonyms ZLYAR; ZC2HC2 Calculated MW 44kDa Observed MW 46kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Nucleus, nucleolus 
Western blot analysis of extracts from normal (control) and LYAR knockout (KO) 293T cells, using LYAR antibody (A19900) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-160 of human LYAR (NP_060286.1). KO Validated Validated Isotype IgG