![[KO Validated] NDUFB5 Rabbit pAb (A19953)](/upload/resize_cache/iblock/13a/340_340_140cd750bba9870f18aada2478b24840a/ie2md8a2dxm8v6jeua6pf833odrai0xi.jpg "[KO Validated] NDUFB5 Rabbit pAb (A19953)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] NDUFB5 Rabbit pAb (A19953)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] NDUFB5 Rabbit pAb Catalog No. A19953 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Three transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-189 of human NDUFB5 (NP_002483.1). Sequence EIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN Gene ID Swiss Prot Synonyms SGDH; CISGDH Calculated MW 22kDa Observed MW 16kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Matrix side, Mitochondrion inner membrane, Single-pass membrane protein 
Western blot analysis of extracts from normal (control) and NDUFB5 knockout (KO) HeLa cells, using NDUFB5 antibody (A19953) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-189 of human NDUFB5 (NP_002483.1). KO Validated Validated Isotype IgG