быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] DNAJC2 Rabbit pAb (A19954)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] DNAJC2 Rabbit pAb Catalog No. A19954 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human DNAJC2 (NP_055192.1). Sequence MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTC Gene ID Swiss Prot Synonyms ZRF1; ZUO1; MPP11; MPHOSPH11 Calculated MW 72kDa Observed MW 80kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Cytoplasm, Nucleus, cytosol 
Western blot analysis of extracts from normal (control) and DNAJC2 knockout (KO) 293T cells, using DNAJC2 antibody (A19954) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human DNAJC2 (NP_055192.1). KO Validated Validated Isotype IgG







