быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CDK2AP1 Rabbit pAb (A19985)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CDK2AP1 Rabbit pAb Catalog No. A19985 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CDK2AP1 (NP_004633.1). Sequence MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS Gene ID Swiss Prot Synonyms DOC1; ST19; DORC1; doc-1; p12DOC-1 Calculated MW 12kDa Observed MW 12kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location cytoplasm, cytosol, nucleoplasm, nucleus, perinuclear region of cytoplasm 
Western blot analysis of extracts from normal (control) and CDK2AP1 knockout (KO) 293T cells, using CDK2AP1 antibody (A19985) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CDK2AP1 (NP_004633.1). KO Validated Validated Isotype IgG







