быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] EIF4G2/p97 Rabbit pAb (A19990)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] EIF4G2/p97 Rabbit pAb Catalog No. A19990 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 750-850 of human EIF4G2/p97 (NP_001409.3). Sequence IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLR Gene ID Swiss Prot Synonyms P97; AAG1; DAP5; NAT1 Calculated MW 102kDa Observed MW 97kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location adherens junction, cytosol, eukaryotic translation initiation factor 4F complex 
Western blot analysis of extracts from normal (control) and EIF4G2/p97 knockout (KO) 293T cells, using EIF4G2/p97 antibody (A19990) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 750-850 of human EIF4G2/p97 (NP_001409.3). KO Validated Validated Isotype IgG







