![[KO Validated] ARL6IP1 Rabbit pAb (A19995)](/upload/resize_cache/iblock/cf0/340_340_140cd750bba9870f18aada2478b24840a/ddtszvxrjplvqcb7etx27jrtn29c8eur.jpg "[KO Validated] ARL6IP1 Rabbit pAb (A19995)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ARL6IP1 Rabbit pAb (A19995)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ARL6IP1 Rabbit pAb Catalog No. A19995 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARL6IP1 (NP_055976.1). Sequence MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTE Gene ID Swiss Prot Synonyms AIP1; ARMER; SPG61; ARL6IP Calculated MW 23kDa Observed MW 23kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T Cellular location cytosol 
Western blot analysis of extracts from normal (control) and ARL6IP1 knockout (KO) 293T cells, using ARL6IP1 antibody (A19995) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARL6IP1 (NP_055976.1). KO Validated Validated Isotype IgG