[KO Validated] CSDE1 Rabbit pAb (A20001)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] CSDE1 Rabbit pAb
Catalog No.	A20001
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables RNA stem-loop binding activity. Involved in IRES-dependent viral translational initiation; nuclear-transcribed mRNA catabolic process, no-go decay; and stress granule assembly. Located in Golgi apparatus; cytosol; and plasma membrane. Part of CRD-mediated mRNA stability complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 369-600 of human CSDE1 (NP_009089.4).
Sequence	LSAQRNHAIRIKKLPKGTVSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSVNGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVEEGDMKGEV
Gene ID
Swiss Prot
Synonyms	UNR; D1S155E
Calculated MW	89kDa
Observed MW	89kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IP
Recommended dilution	WB 1:500 - 1:2000 IP 1:20 - 1:50
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa
Cellular location	Cytoplasm

Western blot analysis of extracts from normal (control) and CSDE1 knockout (KO) HeLa cells, using CSDE1 antibody (A20001) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Key applications	Western blotting, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 369-600 of human CSDE1 (NP_009089.4).
KO Validated	Validated
Isotype	IgG