![[KO Validated] CDX2 Rabbit mAb (A20222)](/upload/resize_cache/iblock/19f/340_340_140cd750bba9870f18aada2478b24840a/2g7affy1wpqun0fz2xo2t99u0ptcopez.jpg "[KO Validated] CDX2 Rabbit mAb (A20222)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CDX2 Rabbit mAb (A20222)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CDX2 Rabbit mAb Catalog No. A20222 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC3070 Background
This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDX2 (Q99626 ). Sequence MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGS Gene ID Swiss Prot Synonyms CDX3; CDX-3; CDX2/AS Calculated MW 34kDa Observed MW 38kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SW620, 293T, Mouse colon Cellular location Nucleus 
Western blot analysis of extracts of SW620 cells, using CDX2 antibody (A20222) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from wild type(WT) and CDX2 knockout (KO) 293T cells, using CDX2 antibody (A20222) at1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of Mouse colon, using CDX2 antibody (A20222) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDX2 (Q99626 ). KO Validated Validated Isotype IgG