![[KO Validated] Hexokinase II Rabbit mAb (A20829)](/upload/resize_cache/iblock/d56/340_340_140cd750bba9870f18aada2478b24840a/bahnsl6hbcxxqo6f3plaznbkt1w2saby.jpg "[KO Validated] Hexokinase II Rabbit mAb (A20829)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Hexokinase II Rabbit mAb (A20829)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Hexokinase II Rabbit mAb Catalog No. A20829 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52060 Background
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase II (NP_000180.2). Sequence MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR Gene ID Swiss Prot Synonyms HKII; HXK2 Calculated MW 102kDa Observed MW 102kD Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, RD, SH-SY5Y, Mouse heart Cellular location Mitochondrion outer membrane, Cytoplasm, cytosol Customer validation WB(Mus musculus)
IHC(Mus musculus)
Western blot analysis of extracts of various lysates, using Hexokinase II Rabbit mAb (A20829) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts from wild type(WT) and Hexokinase II Rabbit mAb knockout (KO) HeLa cells, using Hexokinase II Rabbit mAb (A20829) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Hexokinase II Rabbit mAb (A20829) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase II (NP_000180.2). KO Validated Validated Isotype IgG