![[KO Validated] BRG1/SMARCA4 Rabbit pAb (A2117)](/upload/resize_cache/iblock/cb3/340_340_140cd750bba9870f18aada2478b24840a/ydc5orinxztkhp1a22f6yaqiakmcsncj.jpg "[KO Validated] BRG1/SMARCA4 Rabbit pAb (A2117)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] BRG1/SMARCA4 Rabbit pAb (A2117)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] BRG1/SMARCA4 Rabbit pAb Catalog No. A2117 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Mutations in this gene cause rhabdoid tumor predisposition syndrome type 2. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 680-770 of human BRG1/SMARCA4 (NP_003063.2). Sequence PTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYN Gene ID Swiss Prot Synonyms BRG1; CSS4; SNF2; SWI2; MRD16; RTPS2; BAF190; SNF2L4; SNF2LB; hSNF2b; BAF190A; SNF2-beta Calculated MW 185kDa Observed MW 220kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples 293T Cellular location Nucleus 
Western blot analysis of extracts from normal (control) and BRG1/BRG1/SMARCA4 knockout (KO) 293T cells, using BRG1/BRG1/SMARCA4 antibody (A2117) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using [KO Validated] BRG1/BRG1/SMARCA4 Rabbit pAb (A2117) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse lung using [KO Validated] BRG1/BRG1/SMARCA4 Rabbit pAb (A2117) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of A549 cells using BRG1/BRG1/SMARCA4 antibody (A2117). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg BRG1/SMARCA4 antibody (A2117). Western blot was performed from the immunoprecipitate using BRG1/SMARCA4 antibody (A2117) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 680-770 of human BRG1/SMARCA4 (NP_003063.2). KO Validated Validated Isotype IgG