[KO Validated] MRP4/ABCC4 Rabbit mAb (A21171)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] MRP4/ABCC4 Rabbit mAb
Catalog No.	A21171
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC52221

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1067-1325 of human MRP4/ABCC4 (NP_005836.2).
Sequence	SQEKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNEHTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTIFETAL
Gene ID
Swiss Prot
Synonyms	MRP4; MOATB; MOAT-B
Calculated MW	150kDa
Observed MW	140-200kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, C2C12, Mouse thymus, Rat brain, Rat kidney
Cellular location	Membrane, Multi-pass membrane protein

Western blot analysis of extracts from normal (control) and MRP4/ABCC4 knockout (KO) 293T(KO) cells, using MRP4/ABCC4 antibody (A21171) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of Rat kidney, using MRP4/ABCC4 antibody (A21171) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of Mouse kidney, using MRP4/ABCC4 antibody (A21171) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded human prostate cancer using [KO Validated] MRP4/ABCC4 Rabbit mAb (A21171) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Key applications	Western blotting, Immunohistochemistry
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1067-1325 of human MRP4/ABCC4 (NP_005836.2).
KO Validated	Validated
Isotype	IgG