+7-495-308-45-67 Заказать звонок

[KO Validated] N-Cadherin Rabbit pAb (A21308)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] N-Cadherin Rabbit pAb
Catalog No.	A21308
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 750-850 of human N-Cadherin (NP_001783.2).
Sequence	DKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAP
Gene ID
Swiss Prot
Synonyms	CDHN; NCAD; ACOGS; ADHD8; CD325; ARVD14; CDw325
Calculated MW	100kDa
Observed MW	140kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IP
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, 293T
Cellular location	Cell membrane, Single-pass type I membrane protein

Western blot analysis of extracts of various cell lines, using N-Cadherin antibody (A21308) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of extracts of HeLa cells, using N-Cadherin antibody (A21308) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts of 293T cells, using N-Cadherin antibody (A21308) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts from wild type(WT) and N-Cadherin knockout (KO) HeLa cells, using N-Cadherin antibody (A21308) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using N-Cadherin antibody (A21308) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse liver using N-Cadherin antibody (A21308) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg N-Cadherin antibody (A21308). Western blot was performed from the immunoprecipitate using N-Cadherin antibody (A21308) at a dilution of 1:1000.

Key applications	Western blotting, Immunohistochemistry, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 750-850 of human N-Cadherin (NP_001783.2).
KO Validated	Validated
Isotype	IgG