![[KO Validated] IRF9 Rabbit pAb (A21331)](/upload/resize_cache/iblock/6d9/340_340_140cd750bba9870f18aada2478b24840a/je241iq15c6dcew137oq2wcbuu272ctn.jpg "[KO Validated] IRF9 Rabbit pAb (A21331)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] IRF9 Rabbit pAb (A21331)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] IRF9 Rabbit pAb Catalog No. A21331 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 113-255 of human IRF9 (NP_006075.3). Sequence QLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSME Gene ID Swiss Prot Synonyms p48; IRF-9; ISGF3; ISGF3G Calculated MW 44kDa Observed MW 43kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples A549 Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using IRF9 antibody (A21331) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts from normal (control) and IRF9 knockout (KO) A549 cells, using IRF9 Rabbit pAb (A21331) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 113-255 of human IRF9 (NP_006075.3). KO Validated Validated Isotype IgG