![[KO Validated] FH Rabbit pAb (A21403)](/upload/resize_cache/iblock/a6a/340_340_140cd750bba9870f18aada2478b24840a/r3m3ext6znfui98hygqmmr4bgl2h62ov.jpg "[KO Validated] FH Rabbit pAb (A21403)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] FH Rabbit pAb (A21403)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] FH Rabbit pAb Catalog No. A21403 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human FH (NP_000134.2). Sequence FRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTN Gene ID Swiss Prot Synonyms MCL; FMRD; HsFH; LRCC; HLRCC; MCUL1 Calculated MW 55kDa Observed MW 49kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, Hela, NIH/3T3, C2C12, Rat liver Cellular location Cytoplasm, Mitochondrion 
Western blot analysis of various lysates, using FH Rabbit pAb (A21403) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from wild type(WT) and FH knockout (KO) 293T(KO) cells, using FH antibody (A21403) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human FH (NP_000134.2). KO Validated Validated Isotype IgG