![[KO Validated] IFNAR2 Rabbit pAb (A21462)](/upload/resize_cache/iblock/322/340_340_140cd750bba9870f18aada2478b24840a/hucufsexz55agipspb3vlzkqq20dnu72.jpg "[KO Validated] IFNAR2 Rabbit pAb (A21462)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] IFNAR2 Rabbit pAb (A21462)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] IFNAR2 Rabbit pAb Catalog No. A21462 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The protein belongs to the type II cytokine receptor family. Mutations in this gene are associated with Immunodeficiency 45.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-243 of human IFNAR2 (NP_997468.1). Sequence STHEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESESAESAK Gene ID Swiss Prot Synonyms IFN-R; IMD45; IFNABR; IFNARB; IFN-R-2; IFN-alpha-REC Calculated MW 27kDa/37kDa/57kDa Observed MW 95kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, MCF7, Raji, Mouse liver, Rat liver Cellular location Membrane, Secreted, Single-pass type I membrane protein 
Western blot analysis of various lysates, using IFNAR2 Rabbit pAb antibody (A21462) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from wild type(WT) and IFNAR2 Rabbit pAb knockout (KO) HeLa cells, using IFNAR2 Rabbit pAb antibody (A21462) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-243 of human IFNAR2 (NP_997468.1). KO Validated Validated Isotype IgG