![[KO Validated] LAMP1 Rabbit pAb (A21481)](/upload/resize_cache/iblock/370/340_340_140cd750bba9870f18aada2478b24840a/gb7wws6bf350qrd1lbs57b5tisdfgd9v.jpg "[KO Validated] LAMP1 Rabbit pAb (A21481)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] LAMP1 Rabbit pAb (A21481)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] LAMP1 Rabbit pAb Catalog No. A21481 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LAMP1 (NP_005552.3). Sequence DKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNT Gene ID Swiss Prot Synonyms LAMPA; CD107a; LGP120 Calculated MW 45kDa Observed MW 90-120kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, U-937 Cellular location Cell membrane, Endosome membrane, Late endosome, Lysosome membrane, Single-pass type I membrane protein 
Western blot analysis of U-937, using LAMP1 Rabbit pAb antibody (A21481) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from wild type(WT) and LAMP1 Rabbit pAb knockout (KO) HeLa cells, using LAMP1 Rabbit pAb antibody (A21481) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of HeLa cells using [KO Validated] LAMP1 Rabbit pAb (A21481) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using [KO Validated] LAMP1 Rabbit pAb (A21481) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LAMP1 (NP_005552.3). KO Validated Validated Isotype IgG