[KO Validated] NDUFA4 Rabbit pAb (A21502)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] NDUFA4 Rabbit pAb
Catalog No.	A21502
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1).
Sequence	MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
Gene ID
Swiss Prot
Synonyms	MLRQ; CI-9k; COXFA4; MISTR1; MRCAF1; CI-MLRQ; MC4DN21
Calculated MW	9kDa
Observed MW	10kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T
Cellular location	Matrix side, Mitochondrion inner membrane, Peripheral membrane protein

Western blot analysis of extracts from wild type(WT) and NDUFA4 knockout (KO) 293T(KO) cells, using NDUFA4 antibody (A21502) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunohistochemistry analysis of paraffin-embedded human liver using NDUFA4 Rabbit pAb (A21502) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse brain using NDUFA4 Rabbit pAb (A21502) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat kidney using NDUFA4 Rabbit pAb (A21502) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of L929 cells using NDUFA4 Polyclonal Antibody (A21502) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using NDUFA4 Polyclonal Antibody (A21502) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1).
KO Validated	Validated
Isotype	IgG