![[KO Validated] TTC11/FIS1 Rabbit pAb (A21527)](/upload/resize_cache/iblock/4c9/340_340_140cd750bba9870f18aada2478b24840a/83crtw0y2r55ew2dadr9a09hsqkxazhq.jpg "[KO Validated] TTC11/FIS1 Rabbit pAb (A21527)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] TTC11/FIS1 Rabbit pAb (A21527)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] TTC11/FIS1 Rabbit pAb Catalog No. A21527 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables identical protein binding activity. Involved in several processes, including calcium-mediated signaling using intracellular calcium source; cellular calcium ion homeostasis; and mitochondrion organization. Acts upstream of or within mitochondrion morphogenesis. Located in mitochondrion and peroxisome. Is integral component of mitochondrial outer membrane and integral component of peroxisomal membrane. Part of protein-containing complex. Biomarker of Alzheimer's disease.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11/FIS1 (NP_057152.2). Sequence MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG Gene ID Swiss Prot Synonyms TTC11; CGI-135 Calculated MW 17kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HepG2, MCF7, Mouse brain, Mouse heart, Rat brain Cellular location Mitochondrion outer membrane, Peroxisome membrane, Single-pass membrane protein Customer validation WB(Mus musculus)
Western blot analysis of extracts of various lysates, using TTC11/FIS1 antibody (A21527) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts from wild type(WT) and TTC11/FIS1 knockout (KO) HeLa cells, using TTC11/FIS1 antibody (A21527) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11/FIS1 (NP_057152.2). KO Validated Validated Isotype IgG