![[KO Validated] KEAP1 Rabbit pAb (A21724)](/upload/resize_cache/iblock/7ef/340_340_140cd750bba9870f18aada2478b24840a/xoty2z318rhmpz2k3efynudc8b5bcxdd.jpg "[KO Validated] KEAP1 Rabbit pAb (A21724)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] KEAP1 Rabbit pAb (A21724)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] KEAP1 Rabbit pAb Catalog No. A21724 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human KEAP1 (NP_036421.2). Sequence YLVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMT Gene ID Swiss Prot Synonyms INrf2; KLHL19 Calculated MW 70kDa Observed MW 60-64kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T Cellular location Cytoplasm, Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts from wild type(WT) and KEAP1 Rabbit pAb knockout (KO) 293T cells, using KEAP1 Rabbit pAb antibody (A21724) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] KEAP1 Rabbit pAb (A21724) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using [KO Validated] KEAP1 Rabbit pAb (A21724) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human KEAP1 (NP_036421.2). KO Validated Validated Isotype IgG