![[KO Validated] Ajuba Rabbit pAb (A21760)](/upload/resize_cache/iblock/1c3/340_340_140cd750bba9870f18aada2478b24840a/myn2lf16dsp3wg7wah5uvyn959oxjaed.jpg "[KO Validated] Ajuba Rabbit pAb (A21760)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Ajuba Rabbit pAb (A21760)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Ajuba Rabbit pAb Catalog No. A21760 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables alpha-catenin binding activity and transcription corepressor activity. Involved in several processes, including negative regulation of hippo signaling; positive regulation of gene silencing by miRNA; and regulation of cellular response to hypoxia. Acts upstream of or within gene silencing by miRNA and positive regulation of protein-containing complex assembly. Located in several cellular components, including Golgi apparatus; P-body; and nucleoplasm.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human Ajuba (NP_116265.1). Sequence PSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGT Gene ID Swiss Prot Synonyms JUB Calculated MW 57kDa Observed MW 55kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, Rat kidney Cellular location adherens junction, cell-cell junction, cytosol, Golgi apparatus, microtubule organizing center, nucleoplasm, nucleus, P-body, plasma membrane 
Western blot analysis of HepG2, using Ajuba Rabbit pAb antibody (A21760) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of Rat kidney, using Ajuba Rabbit pAb antibody (A21760) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human Ajuba (NP_116265.1). KO Validated Validated Isotype IgG