быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] HER2/ErbB2 Rabbit pAb (A21768)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] HER2/ErbB2 Rabbit pAb Catalog No. A21768 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1156-1255 of human HER2/ErbB2 (NP_004439.2). Sequence PLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV Gene ID Swiss Prot Synonyms NEU; NGL; HER2; TKR1; CD340; HER-2; VSCN2; MLN 19; MLN-19; c-ERB2; c-ERB-2; HER-2/neu; p185(erbB2) Calculated MW 138kDa Observed MW 185kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, MCF7 Cellular location Cell membrane, Cytoplasm, Nucleus, Nucleus, Single-pass type I membrane protein, perinuclear region 
Western blot analysis of MCF7, using HER2/ErbB2 Rabbit pAb antibody (A21768) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts from wild type(WT) and HER2/ErbB2 Rabbit pAb knockout (KO) HeLa cells, using HER2/ErbB2 Rabbit pAb antibody (A21768) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1156-1255 of human HER2/ErbB2 (NP_004439.2). KO Validated Validated Isotype IgG







