![[KO Validated] MEK7 Rabbit pAb (A2186)](/upload/resize_cache/iblock/f1e/340_340_140cd750bba9870f18aada2478b24840a/1fu79sgabqndmvtw35g5kklzhv7y4qag.jpg "[KO Validated] MEK7 Rabbit pAb (A2186)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] MEK7 Rabbit pAb (A2186)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] MEK7 Rabbit pAb Catalog No. A2186 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinase kinases including MAP3K1/MEKK1, MAP3K2/MEKK2, MAP3K3/MEKK5, and MAP4K2/GCK. This kinase is involved in the signal transduction mediating the cell responses to proinflammatory cytokines, and environmental stresses. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-419 of human MEK7 (NP_660186.1). Sequence DPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR Gene ID Swiss Prot Synonyms MEK; MKK7; JNKK2; MEK 7; MAPKK7; PRKMK7; SAPKK4; SAPKK-4 Calculated MW 47kDa Observed MW 48kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, HeLa, HL-60, Jurkat, PC-3, K-562, Mouse liver, Mouse testis, Mouse brain Cellular location Cytoplasm, Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using MEK7 antibody (A2186) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Western blot analysis of extracts from normal (control) and MEK7 knockout (KO) 293T cells, using MEK7 antibody (A2186) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of C6 cells using MEK7 antibody (A2186) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using MEK7 antibody (A2186) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-419 of human MEK7 (NP_660186.1). KO Validated Validated Isotype IgG