![[KO Validated] Claudin 1 Rabbit mAb (A21971)](/upload/resize_cache/iblock/7c1/340_340_140cd750bba9870f18aada2478b24840a/lyp4xb7lhfgze31go8h9ium013e80s2v.jpg "[KO Validated] Claudin 1 Rabbit mAb (A21971)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Claudin 1 Rabbit mAb (A21971)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Claudin 1 Rabbit mAb Catalog No. A21971 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54475 Background
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. Loss of function mutations result in neonatal ichthyosis-sclerosing cholangitis syndrome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 112-211 of human Claudin 1 (NP_066924.1). Sequence EVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV Gene ID Swiss Prot Synonyms CLD1; SEMP1; ILVASC Calculated MW 23kDa Observed MW 20kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:1000 - 1:5000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples A-431, Hep G2, Mouse liver, Mouse kidney, Rat kidney Cellular location Cell junction, Cell membrane, Multi-pass membrane protein, tight junction Customer validation WB(Sus scrofa, Mus musculus, Anatinae, Coturnix japonica, Homo sapiens)
IHC(Mus musculus)
WB(Mus musculus)
IF(Sus scrofa)
IF(Mus musculus)
Western blot analysis of extracts of various cell lines, using Claudin 1 antibody (A21971) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using Claudin 1 antibody (A21971) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from wild type(WT) and Claudin 1 Rabbit mAb knockdown (KD) Hep G2(KO) , using Claudin 1 Rabbit mAb antibody (A21971) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of Hep G2 using Claudin 1 Rabbit mAb (A21971) at dilution of 1:100(40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 112-211 of human Claudin 1 (NP_066924.1). KO Validated Validated Isotype IgG