+7-495-308-45-67 Заказать звонок

[KO Validated] NF-kB p65/RelA Rabbit mAb (A22331)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] NF-kB p65/RelA Rabbit mAb
Catalog No.	A22331
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51088

Background

NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-kB p65/RelA (NP_068810.3).
Sequence	LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Gene ID
Swiss Prot
Synonyms	p65; CMCU; NFKB3; AIF3BL3
Calculated MW	58kDa/59kDa/60kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse, Rat, Monkey
Tested applications	WB IHC-P IF/ICC IP ChIP
Recommended dilution	WB 1:2000 - 1:10000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ChIP 1:50 - 1:200 IP 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, PC-12, NIH/3T3, Mouse lung
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Homo sapiens)

Western blot analysis of extracts of various cell lines, using NF-kB p65/RelA antibody (A22331) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of extracts from wild type(WT) and NF-kB p65/RelA knockout (KO) HeLa cells, using NF-kB p65/RelA antibody (A22331) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry of paraffin-embedded human colon carcinoma using [KO Validated] NF-kB p65/RelA Rabbit mAb (A22331) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry of paraffin-embedded human liver using [KO Validated] NF-kB p65/RelA Rabbit mAb (A22331) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Confocal imaging of HeLa cells using [KO Validated] NF-kB p65/RelA Rabbit mAb (A22331, dilution 1:100) (Red). The cells were counterstained with MonoMethyl-Histone H3-K4 Rabbit mAb (A22078, dilution 1:300) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Chromatin immunoprecipitation analysis of extracts of HT-1080 cells, HT-1080 cells were treated by TNF-α (20 ng/ml) at 37℃ for 30 minutes, using NF-kB p65/RelA antibody (A22331) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса, Обезьяна
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-kB p65/RelA (NP_068810.3).
KO Validated	Validated
Isotype	IgG