[KO Validated] MSH6 Rabbit mAb (A22652)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] MSH6 Rabbit mAb
Catalog No.	A22652
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57727

Background

This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSH6 (NP_000170.1).
Sequence	MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKM
Gene ID
Swiss Prot
Synonyms	GTBP; HSAP; p160; GTMBP; MSH-6; HNPCC5; LYNCH5; MMRCS3
Calculated MW	153kDa
Observed MW	180kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T, C2C12, NIH/3T3, Rat testis
Cellular location	Chromosome, Nucleus

Western blot analysis of various lysates, using MSH6 antibody (A22652) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of Rat testis, using MSH6 antibody (A22652) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of extracts from wild type(WT) and MSH6 knockout (KO) 293T cells, using MSH6 antibody (A22652) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] MSH6 Rabbit mAb (A22652) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of NIH/3T3 using MSH6 Rabbit mAb (A22652) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSH6 (NP_000170.1).
KO Validated	Validated
Isotype	IgG