+7-495-308-45-67 Заказать звонок

[KO Validated] KRAS Rabbit mAb (A23382)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] KRAS Rabbit mAb
Catalog No.	A23382
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59916

Background

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-188 of human KRAS (NP_203524.1).
Sequence	MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCII
Gene ID
Swiss Prot
Synonyms	NS; NS3; OES; CFC2; RALD; K-Ras; KRAS1; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; K-Ras 2; 'C-K-RAS; c-Ki-ras; c-Ki-ras2
Calculated MW	22kDa
Observed MW	21kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, C2C12, C6
Cellular location	Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, Cytosol

Western blot analysis of various lysates, using KRAS Rabbit mAb (A23382) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 45s.

Western blot analysis of extracts from wild type (WT) and KRAS knockout (KO) 293T cells, using KRAS Rabbit mAb (A23382) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 45s.

Immunohistochemistry analysis of paraffin-embedded human kidney using [KO Validated] KRAS Rabbit mAb (A23382) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using [KO Validated] KRAS Rabbit mAb (A23382) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat heart using [KO Validated] KRAS Rabbit mAb (A23382) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Key applications	Western blotting, Immunohistochemistry
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-188 of human KRAS (NP_203524.1).
KO Validated	Validated
Isotype	IgG