![[KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)](/upload/resize_cache/iblock/349/340_340_140cd750bba9870f18aada2478b24840a/z5n7ggwey3dmddmydt64f8n3mnoftdnr.jpg "[KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CDKN2C/p18-INK4C Rabbit mAb Catalog No. A8751 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1289 Background
The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKN2C/p18-INK4C (P42773). Sequence MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE Gene ID Swiss Prot Synonyms p18; INK4C; p18-INK4C Calculated MW 18kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, 293T, NIH/3T3, Mouse lung, Mouse testis, Rat spleen, Rat kidney Cellular location cytoplasm, cytosol, nucleus Customer validation (Hela 、293T 、KYM-1 、NCl-H460 、SKOV-3 、U2-OS)
Western blot analysis of extracts of various cell lines, using CDKN2C/p18-INK4C Rabbit mAb (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of HepG2 cells, using CDKN2C antibody (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of extracts from wild type(WT) and CDKN2C knockout (KO) 293T cells, using CDKN2C antibody (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunofluorescence analysis of HeLa cells using CDKN2C/p18-INK4C Rabbit mAb (A8751) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKN2C/p18-INK4C (P42773). KO Validated Validated Isotype IgG