![[KO Validated] GSK3β Rabbit pAb (A3174)](/upload/resize_cache/iblock/eee/340_340_140cd750bba9870f18aada2478b24840a/pscil10srfi19g2703zsgaczo60wekxm.jpg "[KO Validated] GSK3β Rabbit pAb (A3174)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] GSK3β Rabbit pAb (A3174)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] GSK3β Rabbit pAb Catalog No. A3174 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction, and apoptotic pathways. Defects in this gene have been associated with Parkinson disease and Alzheimer disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human GSK3β (NP_001139628.1). Sequence PWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Gene ID Swiss Prot Synonyms GSK3B; gsk-3β Calculated MW 47kDa Observed MW 46kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples LO2, HeLa, 22Rv1, U-251MG Cellular location Cell membrane, Cytoplasm, Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using GSK3β antibody (A3174) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from normal (control) and GSK3β knockout (KO) HeLa cells, using GSK3β antibody (A3174) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human GSK3β (NP_001139628.1). KO Validated Validated Isotype IgG